General Information

  • ID:  hor004560
  • Uniprot ID:  E2ASG4
  • Protein name:  SIFamide-related peptide
  • Gene name:  EAG_07408
  • Organism:  Camponotus floridanus (Florida carpenter ant)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed in brain, the retrocerebral complex and in ventral, thoracic and abdominal ganglia (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Camponotus (genus), Camponotini (tribe), Formicinae (subfamily), Formicidae (family), Formicoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AYKKPPFNGSIF
  • Length:  12(24-35)
  • Propeptide:  MVSIRLTFALAIVAIIFAFSVDAAYKKPPFNGSIFGKRSNTMTDYEFTSRALSAICEVASETCTAWMSRQESN
  • Signal peptide:  MVSIRLTFALAIVAIIFAFSVDA
  • Modification:  T12 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E2ASG4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004560_AF2.pdbhor004560_ESM.pdb

Physical Information

Mass: 156497 Formula: C67H97N15O16
Absent amino acids: CDEHLMQRTVW Common amino acids: FKP
pI: 10.25 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -42.5 Boman Index: -765
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 40.83
Instability Index: 2245.83 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  25641051
  • Title:  Neuropeptidomics of the carpenter ant Camponotus floridanus.